PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc06136.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 251aa    MW: 28041.3 Da    PI: 6.7922
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc06136.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72e-161461148
                                    TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                 Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                    rg+WT+eEd  lv  ++++G  +W++ ++  g+ R++k+c++rw +yl
  Zmw_sc06136.1.g00020.1.sm.mkhc 14 RGPWTPEEDRVLVAHIERHGHSNWRALPKQAGLLRCGKSCRLRWINYL 61
                                    89******************************99************97 PP

2Myb_DNA-binding53.26.9e-1767112148
                                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                 Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                     rg++T eE++ +++++++lG++ W++Ia++++ gRt++++k+ w+++l
  Zmw_sc06136.1.g00020.1.sm.mkhc  67 RGNFTREEEDAIIQLHHMLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 112
                                     89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-25564IPR009057Homeodomain-like
PROSITE profilePS5129416.111961IPR017930Myb domain
SuperFamilySSF466891.36E-3010108IPR009057Homeodomain-like
SMARTSM007175.9E-131363IPR001005SANT/Myb domain
PfamPF002491.7E-141461IPR001005SANT/Myb domain
CDDcd001677.56E-111661No hitNo description
PROSITE profilePS5129425.86562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2665116IPR009057Homeodomain-like
SMARTSM007173.2E-1566114IPR001005SANT/Myb domain
PfamPF002496.7E-1667112IPR001005SANT/Myb domain
CDDcd001671.21E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MGRAPCCEKM GLKRGPWTPE EDRVLVAHIE RHGHSNWRAL PKQAGLLRCG KSCRLRWINY  60
LRPDIKRGNF TREEEDAIIQ LHHMLGNRWS AIAARLPGRT DNEIKNVWHT HLKKRLEPKP  120
SNPQQASKRS RHKKQPHEVV LPNGPTTVPV SPEQSLSTTT TTTSAATTDY SAASSSSTLE  180
NADSFSSEEF QIDDSFWSET LAMPVDSSDS SGVETGDDFG ALSAPSSNDD MDFWLQVFMQ  240
AGGVENYLPQ I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-261211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00375DAPTransfer from AT3G23250Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001296459.11e-126myb-related protein Myb4
SwissprotQ7XBH41e-105MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLA0A060CYS61e-126A0A060CYS6_MAIZE; MYB transcription factor (Fragment)
STRINGGRMZM2G095904_P011e-126(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563